General Information

  • ID:  hor006788
  • Uniprot ID:  A0A077D94
  • Protein name:  Spexin prohormone 2
  • Gene name:  spx2
  • Organism:  Danio rerio
  • Family:  Spexin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Otomorpha; Ostariophysi; Otophysi; Cypriniphysae; Cypriniformes (carps and others); Cyprinoidei; Danionidae; Danioninae; Danio; Danio rerio (Zebrafish) (Brachydanio rerio)
  • GO MF:  GO:0005576 extracellular region
  • GO BP:  GO:0005184 neuropeptide hormone activity
  • GO CC:  NA

Sequence Information

  • Sequence:  QKSSLSKNWGPQSMLYLKGKHGRRFVPDIDDHFISNSGLKSWYAVFK
  • Length:  47
  • Propeptide:  MISRVWILWTLVLFLLVTESHCIQKSSLSKNWGPQSMLYLKGKHGRRFVPDIDDHFISNSGLKSWYAVFK
  • Signal peptide:  MISRVWILWTLVLFLLVTESHC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  SPX2 acts as a satiety factor that inhibits food intake by downregulating the expression of agouti-related neuropeptide (agrp).Spx2 mutant fish exhibited a larger body size, excessive lipid accumulation, and insulin resistance.SPX2 functions as a satiety
  • Mechanism:  SPX2 acts as a satiety factor that inhibits food intake by downregulating the expression of agouti-related neuropeptide (agrp).Spx2 mutant fish exhibited a larger body size, excessive lipid accumulation, and insulin resistance.SPX2 functions as a satiety factor involved in energy metabolic regulation in zebrafish.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA